PDB entry 4p41

View 4p41 on RCSB PDB site
Description: Crystal structure of a CDK6/Vcyclin complex with inhibitor bound
Class: transferase/cell cycle/inhibitor
Keywords: Kinase, TRANSFERASE-CELL CYCLE-INHIBITOR complex
Deposited on 2014-03-08, released 2014-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.247
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin homolog
    Species: Saimiriine herpesvirus 2 [TaxId:10383]
    Gene: 72, ECLF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4p41a3, d4p41a4
  • Chain 'B':
    Compound: cyclin-dependent kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK6, CDKN6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4p41b_
  • Heterogens: 24V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p41A (A:)
    madspnrlnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmh
    llcesfeldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvsklt
    ylscdcftnlelinqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaastt
    ickaliqpniallspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkd
    qvseafslydleil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p41A (A:)
    lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
    ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl
    elinqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaasttickaliqpni
    allspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkdqvseafslyd
    leil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p41B (B:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlerckenldshlppsqntselnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p41B (B:)
    cvaeigekvfkardlkngrfvalkrvrvegmplstirevavlrhletfehpnvvrlfdvc
    ttkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqn
    ilvtssgqikladfglariysfqmaltsvvvtlwyrapevllqssyatpvdlwsvgcifa
    emfrrkplfrgssdvdqlgkildviglpgeedwppiekfdidelgkdlllkcltfnpakr
    isaysalshpyfqdle