PDB entry 4p3p

View 4p3p on RCSB PDB site
Description: Structural Basis for Full-Spectrum Inhibition of Threonyl-tRNA Synthetase by Borrelidin 3
Class: ligase/ligase inhibitor
Keywords: synthetase, inhibitor, LIGASE-LIGASE INHIBITOR complex
Deposited on 2014-03-09, released 2015-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Threonine--tRNA ligase
    Species: Escherichia coli [TaxId:562]
    Gene: thrS, b1719, JW1709
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4p3pa1, d4p3pa2
  • Chain 'B':
    Compound: Threonine--tRNA ligase
    Species: Escherichia coli [TaxId:562]
    Gene: thrS, b1719, JW1709
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4p3pb1, d4p3pb2
  • Heterogens: ZN, 2CR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p3pA (A:)
    mrdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmd
    rvlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgs
    chrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkl
    strpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqc
    gtvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapv
    qvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdke
    vesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqleelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p3pA (A:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p3pB (B:)
    mrdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmd
    rvlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgs
    chrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkl
    strpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqc
    gtvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapv
    qvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdke
    vesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqleelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p3pB (B:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee