PDB entry 4p3b

View 4p3b on RCSB PDB site
Description: Crystal structure of the mouse C5a-desArg anaphylatoxin
Class: immune system
Keywords: complement anaphylatoxin, C5a, four-helix bundle, GPCR agonist, IMMUNE SYSTEM
Deposited on 2014-03-06, released 2014-06-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C5
    Species: Mus musculus [TaxId:10090]
    Gene: C5, Hc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06684 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4p3ba1, d4p3ba2
  • Chain 'B':
    Compound: Complement C5
    Species: Mus musculus [TaxId:10090]
    Gene: C5, Hc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06684 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d4p3bb1, d4p3bb2
  • Chain 'C':
    Compound: Complement C5
    Species: Mus musculus [TaxId:10090]
    Gene: C5, Hc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06684 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4p3bc1, d4p3bc2
  • Chain 'D':
    Compound: Complement C5
    Species: Mus musculus [TaxId:10090]
    Gene: C5, Hc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06684 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d4p3bd1, d4p3bd2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p3bA (A:)
    ganlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecc
    tiankirkesphkpvqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p3bA (A:)
    ganlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecc
    tiankirke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p3bB (B:)
    ganlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecc
    tiankirkesphkpvqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p3bB (B:)
    anlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecct
    iankirkes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4p3bC (C:)
    ganlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecc
    tiankirkesphkpvqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p3bC (C:)
    ganlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecc
    tiankirkes
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4p3bD (D:)
    ganlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecc
    tiankirkesphkpvqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p3bD (D:)
    anlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafnecct
    iankirke