SCOPe 2.05: Structural Classification of Proteins

PDB entry 4p2s

View 4p2s on RCSB PDB site
Description: Alanine Scanning Mutagenesis Identifies an Asparagine-Arginine-Lysine Triad Essential to Assembly of the Shell of the Pdu Microcompartment
Class: biosynthetic protein
Keywords: Microcompartment, 1, 2-propanediol, Carboxysome, B12, Biosynthetic protein
Deposited on 2014-03-03, released 2014-05-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.194
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2sa_
Chain 'B':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2sb_
Chain 'C':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2sc_
Chain 'D':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2sd_
Chain 'E':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2se_
Chain 'F':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2sf_
Chain 'G':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2sg_
Chain 'H':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2sh_
Chain 'I':
Compound: Putative propanediol utilization protein PduA
Species: Salmonella enterica subsp. enterica serovar Saintpaul str. SARA26 [TaxId:702982]
Gene: SES26_19178
Database cross-references and differences (RAF-indexed):
- Uniprot V1FW89
  - engineered mutation (32)
Domains in SCOPe 2.05: d4p2si_
Heterogens: SO4, GOL, TRS, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4p2sA (A:)
mhhhhhhmqqealgmvetkgltaaieaadamvasanvmlvgyekigsglvtvivrgdvga
vkaatdagaaaarnvgevkavhviprphtdvekilpkgisq