PDB entry 4p2k

View 4p2k on RCSB PDB site
Description: Structure of Ephrin type-A receptor 2
Class: transferase
Keywords: Epha2, TRANSFERASE
Deposited on 2014-03-04, released 2014-05-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4p2ka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p2kA (A:)
    mgsshhhhhhsqdphtyedpnqavlkftteihpscvtrqkvigagefgevykgmlktssg
    kkevpvaiktlkagytekqrvdflgeagimgqfshhniirlegviskykpmmiiteymen
    galdkflrekdgefsvlqlvgmlrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsd
    fglsrvleddpeatyttsggkipirwtapeaisyrkftsasdvwsfgivmwevmtygerp
    ywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkfadivsildklir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p2kA (A:)
    avlkftteihpscvtrqkvigagefgevykgmlkevpvaiktlkagytekqrvdflgeag
    imgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaa
    gmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvlgkipirwtapeaisyrkftsa
    sdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqe
    rarrpkfadivsildklir