PDB entry 4p2c

View 4p2c on RCSB PDB site
Description: Complex of Shiga toxin 2e with a neutralizing single-domain antibody
Class: toxin
Keywords: Nanobody, Toxin, Complex, Lectin
Deposited on 2014-02-18, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shiga toxin 2e, subunit A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WUF4 (0-End)
      • engineered mutation (76)
      • engineered mutation (166)
      • variant (273)
      • variant (290)
    Domains in SCOPe 2.07: d4p2ca_
  • Chain 'B':
    Compound: Shiga toxin 2e, subunit B
    Species: Escherichia coli [TaxId:562]
    Gene: stxB2e, orf, stx2e B, stx2eB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2cb_
  • Chain 'C':
    Compound: Shiga toxin 2e, subunit B
    Species: Escherichia coli [TaxId:562]
    Gene: stxB2e, orf, stx2e B, stx2eB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2cc_
  • Chain 'D':
    Compound: Shiga toxin 2e, subunit B
    Species: Escherichia coli [TaxId:562]
    Gene: stxB2e, orf, stx2e B, stx2eB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2cd_
  • Chain 'E':
    Compound: Shiga toxin 2e, subunit B
    Species: Escherichia coli [TaxId:562]
    Gene: stxB2e, orf, stx2e B, stx2eB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2ce_
  • Chain 'F':
    Compound: Shiga toxin 2e, subunit B
    Species: Escherichia coli [TaxId:562]
    Gene: stxB2e, orf, stx2e B, stx2eB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2cf_
  • Chain 'G':
    Compound: Nanobody 1, Anti-F4+ETEC bacteria VHH variable region
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2cg_
  • Chain 'H':
    Compound: Nanobody 1, Anti-F4+ETEC bacteria VHH variable region
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2ch_
  • Chain 'I':
    Compound: Nanobody 1, Anti-F4+ETEC bacteria VHH variable region
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2ci_
  • Chain 'J':
    Compound: Nanobody 1, Anti-F4+ETEC bacteria VHH variable region
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2cj1, d4p2cj2
  • Chain 'K':
    Compound: Nanobody 1, Anti-F4+ETEC bacteria VHH variable region
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p2ck_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p2cA (A:)
    qeftidfstqqsyvsslnsirtaistplehisqgatsvsvinhtppgsyisvgirgldvy
    qerfdhlrliiernnlsvagfvntttntfyrfsdfahislpgvttismttdssyttpqrv
    aalersgmqvsrhslvssylalmefsgntmtreasravlrfvtvtaqalrfrqiqrefrq
    alsetapvytmtpedvdltlnwgrisnvlpeyrgeagvrvgrisfnnisailgtvaviln
    chhqgarsvravneesqpecqitgdrpvikitntlwesntaaaflnrksqslyttge
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p2cA (A:)
    qeftidfstqqsyvsslnsirtaistplehisqgatsvsvinhtppgsyisvgirgldvy
    qerfdhlrliiernnlsvagfvntttntfyrfsdfahislpgvttismttdssyttpqrv
    aalersgmqvsrhslvssylalmefsgntmtreasravlrfvtvtaqalrfrqiqrefrq
    alsetapvytmtpedvdltlnwgrisnvlpeyrgeagvrvgrisfnnisailgtvaviln
    checqitgdrpvikitntlwesntaaaflnrksqslyttg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p2cB (B:)
    adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
    gfaqvkfn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p2cC (C:)
    adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
    gfaqvkfn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p2cD (D:)
    adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
    gfaqvkfn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p2cE (E:)
    adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
    gfaqvkfn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p2cF (F:)
    adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
    gfaqvkfn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4p2cG (G:)
    qvqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyr
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtv
    sshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p2cG (G:)
    qvqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyr
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtv
    s
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4p2cH (H:)
    qvqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyr
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtv
    sshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p2cH (H:)
    vqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyrd
    svkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtvs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4p2cI (I:)
    qvqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyr
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtv
    sshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p2cI (I:)
    vqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyrd
    svkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtvs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4p2cJ (J:)
    qvqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyr
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtv
    sshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p2cJ (J:)
    vqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyrd
    svkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtvs
    shhhhhh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4p2cK (K:)
    qvqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyr
    dsvkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtv
    sshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p2cK (K:)
    vqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyrd
    svkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtvs