PDB entry 4p0u

View 4p0u on RCSB PDB site
Description: YhdE E33A p4 space group
Class: unknown function
Keywords: YhdE, E33A mutant, unknown function
Deposited on 2014-02-23, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maf-like protein YceF
    Species: Escherichia coli [TaxId:1182738]
    Gene: yceF, A31Q_03875
    Database cross-references and differences (RAF-indexed):
    • Uniprot L3WSY9 (0-End)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d4p0ua_
  • Chain 'B':
    Compound: Maf-like protein YceF
    Species: Escherichia coli [TaxId:1182738]
    Gene: yceF, A31Q_03875
    Database cross-references and differences (RAF-indexed):
    • Uniprot L3WSY9 (0-189)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d4p0ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p0uA (A:)
    slylasgsprrqellaqlgvtferivtgieaqrqpqesaqqyvvrlarekaragvaqtak
    dlpvlgadtivilngevlekprdaehaaqmlrklsgqthqvmtavaladsqhildclvvt
    dvtfrtltdediagyvasdepldkagaygiqglggcfvrkingsyhavvglplvetyell
    snfnalrekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p0uA (A:)
    slylasgsprrqellaqlgvtferivtgieaqrqpqesaqqyvvrlarekaragvaqtak
    dlpvlgadtivilngevlekprdaehaaqmlrklsgqthqvmtavaladsqhildclvvt
    dvtfrtltdediagyvasdepldkagaygiqglggcfvrkingsyhavvglplvetyell
    snfnal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p0uB (B:)
    slylasgsprrqellaqlgvtferivtgieaqrqpqesaqqyvvrlarekaragvaqtak
    dlpvlgadtivilngevlekprdaehaaqmlrklsgqthqvmtavaladsqhildclvvt
    dvtfrtltdediagyvasdepldkagaygiqglggcfvrkingsyhavvglplvetyell
    snfnalrekr