PDB entry 4p0n

View 4p0n on RCSB PDB site
Description: Crystal structure of PDE10a with a novel Imidazo[4,5-b]pyridine inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 2014-02-21, released 2014-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.16
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p0na_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p0nb_
  • Heterogens: 1IS, 1IR, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p0nA (A:)
    tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
    imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
    nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
    atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
    iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
    lkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p0nA (A:)
    tlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrv
    pyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpl
    aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
    kqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
    mkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqw
    ekvirge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p0nB (B:)
    tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
    imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
    nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
    atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
    iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
    lkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p0nB (B:)
    ftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrr
    vpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhp
    laalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgn
    rkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegd
    emkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsq
    wekvirge