PDB entry 4p0l

View 4p0l on RCSB PDB site
Description: Crystal Structure of Double Loop-Swapped Interleukin-36Ra With Additional Point Mutations
Class: cytokine
Keywords: chimera protein, interleukin, CYTOKINE
Deposited on 2014-02-21, released 2014-06-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-36 receptor antagonist/Interleukin-36 gamma chimera protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBH0 (Start-47)
    • Uniprot Q9NZH8 (48-56)
    • Uniprot Q9UBH0 (57-137)
      • engineered mutation (105)
      • engineered mutation (107)
    • Uniprot Q9NZH8 (138-144)
    • Uniprot Q9UBH0 (145-End)
    Domains in SCOPe 2.08: d4p0la_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4p0lA (A:)
slsgalcfrmkdsalkvlylhnnqllagglhagkvikgeeisvvpnrwpealeqgrgspv
ilgvqggsqclscgvgqeptltlepvnimelylgakesksftfyradagltssfesaayp
gwflctvpeadqpvrltqelgksyntdfyfqqcd

    Sequence, based on observed residues (ATOM records): (download) 
    >4p0lA (A:)
lcfrmkdsalkvlylhnnqllagglikgeeisvvpnrwpealeqgrgspvilgvqggsqc
lscgvgqeptltlepvnimelylgakesksftfyradagltssfesaaypgwflctvpea
dqpvrltqelgksyntdfyfqqc