PDB entry 4p0h

View 4p0h on RCSB PDB site
Description: Crystal Structure Analysis of Macrophage Migration Inhibitory Factor in complex with Dimethylformamide
Class: isomerase/isomerase inhibitor
Keywords: inhibitor, trimer, complex, active site, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2014-02-21, released 2014-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4p0ha_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4p0hb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4p0hc_
  • Heterogens: DMF, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p0hA (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p0hB (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p0hC (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa