PDB entry 4p0e

View 4p0e on RCSB PDB site
Description: YhdE E33A (p212121 space group)
Class: unknown function
Keywords: YhdE E33A p212121, unknown function
Deposited on 2014-02-21, released 2014-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maf-like protein YhdE
    Species: Escherichia coli [TaxId:83333]
    Gene: yhdE, b3248, JW3217
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25536 (0-188)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d4p0ea_
  • Chain 'B':
    Compound: Maf-like protein YhdE
    Species: Escherichia coli [TaxId:83333]
    Gene: yhdE, b3248, JW3217
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25536 (Start-188)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d4p0eb_
  • Heterogens: PO4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p0eA (A:)
    tslylasgsprrqellaqlgvtferivtgieaqrqpqesaqqyvvrlarekaragvaqta
    kdlpvlgadtivilngevlekprdaehaaqmlrklsgqthqvmtavaladsqhildclvv
    tdvtfrtltdediagyvasdepldkagaygiqglggcfvrkingsyhavvglplvetyel
    lsnfnalre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p0eB (B:)
    tslylasgsprrqellaqlgvtferivtgieaqrqpqesaqqyvvrlarekaragvaqta
    kdlpvlgadtivilngevlekprdaehaaqmlrklsgqthqvmtavaladsqhildclvv
    tdvtfrtltdediagyvasdepldkagaygiqglggcfvrkingsyhavvglplvetyel
    lsnfnalre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p0eB (B:)
    slylasgsprrqellaqlgvtferivtgieaqrqpqesaqqyvvrlarekaragvaqtak
    dlpvlgadtivilngevlekprdaehaaqmlrklsgqthqvmtavaladsqhildclvvt
    dvtfrtltdediagyvasdepldkagaygiqglggcfvrkingsyhavvglplvetyell
    snfnalre