PDB entry 4p0c

View 4p0c on RCSB PDB site
Description: Crystal Structure of NHERF2 PDZ1 Domain in Complex with LPA2
Class: protein binding
Keywords: PDZ, protein-protein interaction, PROTEIN BINDING
Deposited on 2014-02-20, released 2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.147
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF2/Lysophosphatidic acid receptor 2 chimeric protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15599 (1-82)
      • initiating methionine (0)
    • Uniprot Q9HBW0 (83-87)
    Domains in SCOPe 2.08: d4p0ca1, d4p0ca2
  • Heterogens: SCN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4p0cA (A:)
mprlcrlvrgeqgygfhlhgekgrrgqfirrvepgspaeaaalragdrlvevngvnvege
thhqvvqrikavegqtrllvvdqmdstl