PDB entry 4ozr

View 4ozr on RCSB PDB site
Description: Crystal structure of the ligand binding domains of the Bovicola ovis ecdysone receptor EcR/USP heterodimer (methylene lactam crystal)
Class: transcription
Keywords: Ecdysone receptor, USP, methylene lactam, heterodimer, ligand binding domain, TRANSCRIPTION
Deposited on 2014-02-18, released 2014-07-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Ecdysone receptor
    Species: Pediculus humanus subsp. corporis [TaxId:121224]
    Gene: Phum_PHUM467460
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0VVT4 (0-196)
      • conflict (89)
  • Chain 'U':
    Compound: retinoid x receptor
    Species: Pediculus humanus subsp. corporis [TaxId:121224]
    Gene: Phum_PHUM164330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ozru_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ozrU (U:)
    aanavanicqatntqlyqlvewakhiphfsslpiedqvlllragwnelliaafshrsvev
    rdgivlgagitvhrnsahqagvgtifdrvltelvakmrdmnmdrtelgslrsiilfnpev
    rglksgqevellrekvyaaleeytrvtrpeepgrfaklllrlpalrsiglkclehlfffr
    ligdipidtflmdmlg