PDB entry 4oz5

View 4oz5 on RCSB PDB site
Description: Bacillus subtilis HmoB
Deposited on 2014-02-13, released 2015-02-18
The last revision was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.197
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacillus subtilis HmoB
    Species: Bacillus subtilis subsp. spizizenii [TaxId:703612]
    Gene: BSU6633_15062
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5N3U6 (0-154)
      • conflict (151)
  • Heterogens: HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4oz5A (A:)
mkvyitygtadflktivkkhpsenillmqgqenailihetsgdtvfqaphayevidqvge
ikhpgfavlnniavtqegrplfenkfknragkvenepgfeairvlrpldsdtyviltlwe
terafqdwqqsdsykeahkkifsrpsyvttyfave