PDB entry 4oyy

View 4oyy on RCSB PDB site
Description: Humicola insolens cutinase
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-02-13, released 2014-07-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.175
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY
• Chain 'B':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY
  Domains in SCOPe 2.04: d4oyyb_
• Chain 'C':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY (0-End)
• Chain 'D':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY
• Chain 'E':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY
• Chain 'F':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY (0-End)
• Chain 'G':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY (0-End)
• Chain 'H':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY
• Chain 'I':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY (0-End)
• Chain 'J':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY
• Chain 'K':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY
• Chain 'L':
  Compound: cutinase
  Species: Humicola insolens [TaxId:34413]
  Database cross-references and differences (RAF-indexed):
  • PDB 4OYY
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4oyyB (B:)
  qlgaienglesgsanacpdailifargstepgnmgitvgpalangleshirniwiqgvgg
  pydaalatnflprgtsqanidegkrlfalanqkcpntpvvaggysqgaaliaaavselsg
  avkeqvkgvalfgytqnlqnrggipnyprertkvfcnvgdavctgtliitpahlsytiea
  rgeaarflrdrira
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4oyyB (B:)
  gaienglesgsanacpdailifargstepgnmgitvgpalangleshirniwiqgvggpy
  daalatnflprgtsqanidegkrlfalanqkcpntpvvaggysqgaaliaaavselsgav
  keqvkgvalfgytqnlqnrggipnyprertkvfcnvgdavctgtliitpahlsytiearg
  eaarflrdrir
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.