PDB entry 4oy9

View 4oy9 on RCSB PDB site
Description: Crystal structure of human P-Cadherin EC1-EC2 in closed conformation
Class: cell adhesion
Keywords: adhesion, cadherin, calcium-binding protein., CELL ADHESION
Deposited on 2014-02-11, released 2015-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH3,CDHP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4oy9a1, d4oy9a2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4oy9A (A:)
dwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwl
llnkpldreeiakyelfghavsengasvedpmnisiivtdqndhkpkftqdtfrgsvleg
vlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdlmftihrstgtisvissgld
rekvpeytltiqatdmdgdgstttavavveild