PDB entry 4oy8

View 4oy8 on RCSB PDB site
Description: Structure of ScLPMO10B in complex with zinc.
Class: oxidoreductase
Keywords: LPMO, AA10, CBM33, PMO, GH61, cellulose degradation, copper monooxygenase, OXIDOREDUCTASE
Deposited on 2014-02-11, released 2014-05-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative secreted cellulose-binding protein
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SCO0643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4oy8a_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oy8A (A:)
    hgsvvdpasrnygcwerwgddfqnpamadedpmcwqawqddpnamwnwnglyrngsagdf
    eavvpdgqlcsggrtesgrynsldavgpwqttdvtddftvklhdqashgadyflvyvtkq
    gfdpatqaltwgelqqvartgsygpsqnyeipvstsgltgrhvvytiwqashmdqtyflc
    sdvdfg