PDB entry 4oy6

View 4oy6 on RCSB PDB site
Description: Structure of ScLPMO10B in complex with copper.
Class: oxidoreductase
Keywords: LPMO, AA10, CBM33, PMO, GH61, cellulose degradation, copper monooxygenase
Deposited on 2014-02-11, released 2014-05-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.125
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative secreted cellulose-binding protein
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: SCO0643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4oy6a_
  • Heterogens: CU, ZN, NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4oy6A (A:)
hgsvvdpasrnygcwerwgddfqnpamadedpmcwqawqddpnamwnwnglyrngsagdf
eavvpdgqlcsggrtesgrynsldavgpwqttdvtddftvklhdqashgadyflvyvtkq
gfdpatqaltwgelqqvartgsygpsqnyeipvstsgltgrhvvytiwqashmdqtyflc
sdvdfg