PDB entry 4owz

View 4owz on RCSB PDB site
Description: Structure of ECP/H15A mutant.
Class: hydrolase
Keywords: RNase 3, Eosinophil Cationic Protein
Deposited on 2014-02-04, released 2015-03-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eosinophil cationic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ECP,RNASE3,RNS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12724 (1-133)
      • initiating methionine (0)
      • engineered mutation (15)
      • variant (97)
    Domains in SCOPe 2.05: d4owza_
  • Chain 'B':
    Compound: eosinophil cationic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ECP,RNASE3,RNS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12724 (1-133)
      • initiating methionine (0)
      • engineered mutation (15)
      • variant (97)
    Domains in SCOPe 2.05: d4owzb_
  • Heterogens: CIT, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4owzA (A:)
    mrppqftraqwfaiqaislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqs
    ircphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprds
    prypvvpvhldtti
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4owzB (B:)
    mrppqftraqwfaiqaislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqs
    ircphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprds
    prypvvpvhldtti