PDB entry 4ovo

View 4ovo on RCSB PDB site
Description: refined x-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (omsvp3(asterisk)) and from japanese quail (omjpq3(asterisk))
Class: proteinase inhibitor (kazal)
Keywords: proteinase inhibitor (kazal)
Deposited on 1991-05-13, released 1993-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ovomucoid third domain cleaved rdi
    Species: Lophura nycthemera [TaxId:9046]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ovoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ovoA (A:)
    laavsvdcseypkpactmeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc