PDB entry 4ov6

View 4ov6 on RCSB PDB site
Description: Crystal structure of PCSK9(53-451) with Adnectin
Class: hydrolase/protein binding
Keywords: PCSK9, Adnectin, LDL-cholesterol, HYDROLASE-PROTEIN BINDING complex
Deposited on 2014-02-20, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ov6b_
  • Chain 'D':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ov6e_
  • Chain 'F':
    Compound: adnectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OV6 (0-98)
    Domains in SCOPe 2.07: d4ov6f_
  • Chain 'G':
    Compound: adnectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OV6 (0-End)
    Domains in SCOPe 2.07: d4ov6g_
  • Heterogens: EDO, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ov6B (B:)
    sipwnleritppryradeyqppdggslvevylldtsiqsdhreiegrvmvtdfenvpeed
    gtrfhrqaskcdshgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefir
    ksqlvqpvgplvvllplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasape
    vitvgatnaqdqpvtlgtlgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahv
    agiaammlsaepeltlaelrqrlihfsakdvineawfpedqrvltpnlvaalpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ov6B (B:)
    sipwnleritppslvevylldtsiqsdhreiegrvmvtdfenvpeedgtrfhrqaskcds
    hgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefirksqlvqpvgplvv
    llplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasapevitvgatnaqdqp
    vtlgtlgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahvagiaammlsaepe
    ltlaelrqrlihfsakdvineawfpedqrvltpnlvaalpp
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ov6E (E:)
    sipwnleritppryradeyqppdggslvevylldtsiqsdhreiegrvmvtdfenvpeed
    gtrfhrqaskcdshgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefir
    ksqlvqpvgplvvllplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasape
    vitvgatnaqdqpvtlgtlgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahv
    agiaammlsaepeltlaelrqrlihfsakdvineawfpedqrvltpnlvaalpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ov6E (E:)
    sipwnleritplvevylldtsiqsdhreiegrvmvtdfenvpeedskcdshgthlagvvs
    grdagvakgasmrslrvlncqgkgtvsgtliglefirksqlvqpvgplvvllplaggysr
    vlnaacqrlaragvvlvtaagnfrddaclyspasapevitvgatnaqdqpvtlgtlgtnf
    grcvdlfapgediigassdcstcfvsqsgtsqaaahvagiaammlsaepeltlaelrqrl
    ihfsakdvineawfpedqrvltpnlvaalp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ov6F (F:)
    gvsdvprdlevvaatptslliswpppshgygyyritygetggnspvqeftvppgkgtati
    sglkpgvdytitvyaveypykhsgyyhrpisinyrteid
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ov6G (G:)
    gvsdvprdlevvaatptslliswpppshgygyyritygetggnspvqeftvppgkgtati
    sglkpgvdytitvyaveypykhsgyyhrpisinyrteid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ov6G (G:)
    gvsdvprdlevvaatptslliswpppshgygyyritygetggnspvqeftvppgkgtati
    sglkpgvdytitvyaveypykhsgyyhrpisinyrt