PDB entry 4ouo

View 4ouo on RCSB PDB site
Description: anti-Bla g 1 scFv
Class: immune system
Keywords: cockroach allergen, IgG, scFv antibody fragment, Bla g 1, IMMUNE SYSTEM
Deposited on 2014-02-18, released 2014-03-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti Bla g 1 scFv
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OUO
    Domains in SCOPe 2.04: d4ouoa1, d4ouoa2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ouoA (A:)
    gsftqaaltqpssvsanpgetvkitcsgggsssnygwfqqkspgsapvtviynnnnrpsd
    ipsrfsgsksgstatltitgvqaddeavyfcggrdstyagmfgagttltvlgqssrssav
    tldesggglqtpggalslvckasgftfsvydmmwvrqapskglewvagigitgstyyasa
    vkgratisrdngqstvrlqlnnlraedtgtyycarggaysinkldtwgqgtevivss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ouoA (A:)
    sftqaaltqpssvsanpgetvkitcsgggsssnygwfqqkspgsapvtviynnnnrpsdi
    psrfsgsksgstatltitgvqaddeavyfcggrdstyagmfgagttltvlavtldesggg
    lqtpggalslvckasgftfsvydmmwvrqapskglewvagigitgstyyasavkgratis
    rdngqstvrlqlnnlraedtgtyycarggaysinkldtwgqgteviv