PDB entry 4oun

View 4oun on RCSB PDB site
Description: Crystal Structure of Mini-ribonuclease 3 from Bacillus subtilis
Class: hydrolase
Keywords: RNase III domain-like, Ribonuclease, RNA binding, HYDROLASE
Deposited on 2014-02-18, released 2015-02-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mini-ribonuclease 3
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: mrnC, yazC, BSU00950
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31418
      • engineered mutation (125)
    Domains in SCOPe 2.05: d4ouna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ounA (A:)
mgsshhhhhhssglvprgshmlefdtikdskqlnglalayigdaifevyvrhhllkqgft
kpndlhkkssrivsaksqaeilfflqnqsffteeeeavlkrgrnaksgttpkntdvqtyr
ystafqallgylflekkeerlsqlvaeaiqfgtsgrktnesat

    Sequence, based on observed residues (ATOM records): (download) 
    >4ounA (A:)
fdtikdskqlnglalayigdaifevyvrhhllkqgftkpndlhkkssrivsaksqaeilf
flqnqsffteeeeavlkrgrnakntdvqtyrystafqallgylflekkeerlsqlvaeai
qfgts