PDB entry 4oum

View 4oum on RCSB PDB site
Description: Crystal structure of human Caprin-2 C1q domain
Class: signaling protein
Keywords: C1q domain, Wnt signaling, SIGNALING PROTEIN
Deposited on 2014-02-18, released 2014-10-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caprin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QDC1, CAPRIN2, EEG1, KIAA1873, RNG140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IMN6 (0-131)
      • engineered mutation (82)
      • engineered mutation (88)
    Domains in SCOPe 2.08: d4ouma_
  • Heterogens: PG4, FLC, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oumA (A:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayanagapdhatasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oumA (A:)
    mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
    vnvplyvnlmkneevlvsayanagapdhatasnhailqlfqgdqiwlrlhrgaiygsswk
    ystfsgyllyqd