PDB entry 4ou3

View 4ou3 on RCSB PDB site
Description: Crystal structure of porcine aminopeptidase N complexed with CNGRCG tumor-homing peptide
Class: hydrolase/protein binding
Keywords: zinc-aminopeptidase, HYDROLASE-PROTEIN BINDING complex
Deposited on 2014-02-14, released 2014-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.143
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15145 (0-900)
      • conflict (44)
      • expression tag (901)
    Domains in SCOPe 2.07: d4ou3a1, d4ou3a2, d4ou3a3, d4ou3a4, d4ou3a5
  • Chain 'B':
    Compound: tumor-homing peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4OU3 (0-5)
  • Heterogens: ZN, NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ou3A (A:)
    qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
    lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
    ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
    nmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpn
    aiaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenal
    lfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaep
    twnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirml
    snfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlq
    mgfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvs
    qaqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviyds
    fnlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkq
    veplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpen
    npihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnryl
    gytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgv
    trrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfieh
    sshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ou3A (A:)
    qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
    lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
    ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
    nmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpn
    aiaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenal
    lfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaep
    twnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirml
    snfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlq
    mgfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvs
    qaqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviyds
    fnlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkq
    veplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpen
    npihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnryl
    gytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgv
    trrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfieh
    ss
    

  • Chain 'B':
    No sequence available.