PDB entry 4ou0

View 4ou0 on RCSB PDB site
Description: Crystal Structure of RPA32C
Class: DNA binding protein
Keywords: winged-helix turn helix, protein-protein interaction, S-Methyl-Thio-Cysteine, DNA BINDING PROTEIN
Deposited on 2014-02-14, released 2014-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 32 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: REPA2, RFA2, RPA2, RPA32, RPA34
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ou0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ou0A (A:)
gpgsangltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiys
tvdddhfkstdae

    Sequence, based on observed residues (ATOM records): (download) 
    >4ou0A (A:)
ngltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvddd
hfkstd