PDB entry 4otx

View 4otx on RCSB PDB site
Description: Structure of the anti-Francisella tularensis O-antigen antibody N203 Fab fragment
Class: immune system
Keywords: antibody, immune system, lipopolysaccharide, internal epitope
Deposited on 2014-02-14, released 2014-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: N203 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4OTX (0-212)
  • Chain 'I':
    Compound: N203 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4OTX (0-212)
  • Chain 'L':
    Compound: N203 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4OTX (0-End)
    Domains in SCOPe 2.07: d4otxl1, d4otxl2
  • Chain 'M':
    Compound: N203 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4OTX (0-218)
    Domains in SCOPe 2.07: d4otxm1, d4otxm2
  • Heterogens: CL, AZI, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4otxL (L:)
    qivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4otxL (L:)
    qivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceapivksfnrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4otxM (M:)
    qivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4otxM (M:)
    qivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceatpivksfnrne