PDB entry 4ot2

View 4ot2 on RCSB PDB site
Description: Crystal Structure of Equine Serum Albumin in complex with Naproxen
Class: transport protein
Keywords: Helical, Three-domain protein, Serum Albumin Superfamily, TRANSPORT PROTEIN, Fatty acids, metabolites and drugs, Naproxen, Plasma
Deposited on 2014-02-13, released 2014-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.182
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ot2a1, d4ot2a2, d4ot2a3
  • Heterogens: NPS, SIN, ACT, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ot2A (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgredkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ot2A (A:)
    kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
    kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
    aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipklda
    lkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhke
    cchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpa
    laadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaea
    dppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptlv
    eigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslaer
    rpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeql
    ktvlgnfsafvakccgredkeacfaeegpklvassqlala