PDB entry 4osp

View 4osp on RCSB PDB site
Description: The crystal structure of urdamycin C-6 ketoreductase domain UrdMred with bound NADP and rabelomycin
Class: Oxidoreductase/Antibiotic
Keywords: Rossmann fold, ketoreductase, NADPH binding, Oxidoreductase-Oxidoreductase inhibitor complex, Oxidoreductase-Antibiotic complex
Deposited on 2014-02-13, released 2014-10-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxygenase-reductase
    Species: Streptomyces fradiae [TaxId:1906]
    Gene: urdM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ospa_
  • Chain 'B':
    Compound: Oxygenase-reductase
    Species: Streptomyces fradiae [TaxId:1906]
    Gene: urdM
    Database cross-references and differences (RAF-indexed):
    • Uniprot K0IB23 (11-262)
      • expression tag (10)
    Domains in SCOPe 2.08: d4ospb1, d4ospb2
  • Chain 'C':
    Compound: Oxygenase-reductase
    Species: Streptomyces fradiae [TaxId:1906]
    Gene: urdM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ospc_
  • Chain 'D':
    Compound: Oxygenase-reductase
    Species: Streptomyces fradiae [TaxId:1906]
    Gene: urdM
    Database cross-references and differences (RAF-indexed):
    • Uniprot K0IB23 (11-262)
      • expression tag (10)
    Domains in SCOPe 2.08: d4ospd1, d4ospd2
  • Heterogens: NAP, 2V4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ospA (A:)
    mahhhhhhhrsgkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvat
    iekeggrafsvlaelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevt
    pelfdrlvavnakapffivqraltlipdggriinissgltrfanpqevayamtkgamdql
    tlhfakhlgsrnitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaf
    lagddarwitgsyldasggtllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ospA (A:)
    gkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvatiekeggrafsv
    laelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevtpelfdrlvavn
    akapffivqraltlipdggriinissgltrfanpqevayamtkgamdqltlhfakhlgsr
    nitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaflagddarwitg
    syldasggtllg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ospB (B:)
    mahhhhhhhrsgkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvat
    iekeggrafsvlaelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevt
    pelfdrlvavnakapffivqraltlipdggriinissgltrfanpqevayamtkgamdql
    tlhfakhlgsrnitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaf
    lagddarwitgsyldasggtllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ospB (B:)
    sgkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvatiekeggrafs
    vlaelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevtpelfdrlvav
    nakapffivqraltlipdggriinissgltrfanpqevayamtkgamdqltlhfakhlgs
    rnitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaflagddarwit
    gsyldasggtllg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ospC (C:)
    mahhhhhhhrsgkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvat
    iekeggrafsvlaelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevt
    pelfdrlvavnakapffivqraltlipdggriinissgltrfanpqevayamtkgamdql
    tlhfakhlgsrnitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaf
    lagddarwitgsyldasggtllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ospC (C:)
    gkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvatiekeggrafsv
    laelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevtpelfdrlvavn
    akapffivqraltlipdggriinissgltrfanpqevayamtkgamdqltlhfakhlgsr
    nitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaflagddarwitg
    syldasggtllg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ospD (D:)
    mahhhhhhhrsgkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvat
    iekeggrafsvlaelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevt
    pelfdrlvavnakapffivqraltlipdggriinissgltrfanpqevayamtkgamdql
    tlhfakhlgsrnitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaf
    lagddarwitgsyldasggtllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ospD (D:)
    sgkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvatiekeggrafs
    vlaelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevtpelfdrlvav
    nakapffivqraltlipdggriinissgltrfanpqevayamtkgamdqltlhfakhlgs
    rnitvnsvgpgitnpeavaqmagysvfnrvgevtdvadvvaflagddarwitgsyldasg
    gtllg