PDB entry 4osh

View 4osh on RCSB PDB site
Description: Crystal structure of the TAL effector dHax3 with NI RVD at 2.2 angstrom resolution
Class: DNA binding protein/DNA
Keywords: DNA binding protein, DNA, DNA binding protein-DNA complex
Deposited on 2014-02-13, released 2014-05-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hax3
    Species: Xanthomonas campestris pv. armoraciae [TaxId:329463]
    Gene: hax3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3ZD72
      • engineered mutation (70-71)
      • engineered mutation (138-139)
      • engineered mutation (172-173)
      • engineered mutation (206-207)
      • engineered mutation (240-241)
      • engineered mutation (275)
      • engineered mutation (309)
      • engineered mutation (342-343)
      • engineered mutation (376-377)
      • engineered mutation (410-411)
    Domains in SCOPe 2.05: d4osha_
  • Chain 'B':
    Compound: Hax3
    Species: Xanthomonas campestris pv. armoraciae [TaxId:329463]
    Gene: hax3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3ZD72 (Start-490)
      • engineered mutation (70-71)
      • engineered mutation (138-139)
      • engineered mutation (172-173)
      • engineered mutation (206-207)
      • engineered mutation (240-241)
      • engineered mutation (275)
      • engineered mutation (309)
      • engineered mutation (342-343)
      • engineered mutation (376-377)
      • engineered mutation (410-411)
      • expression tag (491)
    Domains in SCOPe 2.05: d4oshb_
  • Chain 'G':
    Compound: DNA (5'-d(*tp*gp*tp*cp*cp*cp*tp*tp*tp*ap*tp*cp*tp*cp*tp*cp*t)-3')
  • Chain 'H':
    Compound: DNA (5'-d(*ap*gp*ap*gp*ap*gp*ap*tp*ap*ap*ap*gp*gp*gp*ap*cp*a)-3')
  • Chain 'I':
    Compound: DNA (5'-d(*tp*gp*tp*cp*cp*cp*tp*tp*tp*ap*tp*cp*tp*cp*tp*cp*t)-3')
  • Chain 'J':
    Compound: DNA (5'-d(*ap*gp*ap*gp*ap*gp*ap*tp*ap*ap*ap*gp*gp*gp*ap*cp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oshA (A:)
    mqwsgaralealltvagelrgpplqldtgqllkiakrggvtaveavhawrnaltgaplnl
    tpeqvvaiashdggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllp
    vlcqahgltpeqvvaiashdggkqaletvqallpvlcqahgltpeqvvaiasngggkqal
    etvqrllpvlcqahgltpqqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaias
    ngggkqaletvqrllpvlcqahgltpqqvvaiasniggkqaletvqrllpvlcqahgltp
    qqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvl
    cqahgltpeqvvaiasngggkqaletvqrllpvlcqahgltpeqvvaiashdggkqalet
    vqrllpvlcqahgltpqqvvaiasngggrpalesivaqlsrpdpalaaltndhlvalacl
    ggrpaldavkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oshA (A:)
    wsgaralealltvagelrgpplqldtgqllkiakrggvtaveavhawrnaltgaplnltp
    eqvvaiashdggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvl
    cqahgltpeqvvaiashdggkqaletvqallpvlcqahgltpeqvvaiasngggkqalet
    vqrllpvlcqahgltpqqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaiasng
    ggkqaletvqrllpvlcqahgltpqqvvaiasniggkqaletvqrllpvlcqahgltpqq
    vvaiasngggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlcq
    ahgltpeqvvaiasngggkqaletvqrllpvlcqahgltpeqvvaiashdggkqaletvq
    rllpvlcqahgltpqqvvaiasngggrpalesivaqlsrpdpalaaltndhlvalaclgg
    rpaldav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oshB (B:)
    mqwsgaralealltvagelrgpplqldtgqllkiakrggvtaveavhawrnaltgaplnl
    tpeqvvaiashdggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllp
    vlcqahgltpeqvvaiashdggkqaletvqallpvlcqahgltpeqvvaiasngggkqal
    etvqrllpvlcqahgltpqqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaias
    ngggkqaletvqrllpvlcqahgltpqqvvaiasniggkqaletvqrllpvlcqahgltp
    qqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvl
    cqahgltpeqvvaiasngggkqaletvqrllpvlcqahgltpeqvvaiashdggkqalet
    vqrllpvlcqahgltpqqvvaiasngggrpalesivaqlsrpdpalaaltndhlvalacl
    ggrpaldavkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oshB (B:)
    sgaralealltvagelrgpplqldtgqllkiakrggvtaveavhawrnaltgaplnltpe
    qvvaiashdggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlc
    qahgltpeqvvaiashdggkqaletvqallpvlcqahgltpeqvvaiasngggkqaletv
    qrllpvlcqahgltpqqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaiasngg
    gkqaletvqrllpvlcqahgltpqqvvaiasniggkqaletvqrllpvlcqahgltpqqv
    vaiasngggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlcqa
    hgltpeqvvaiasngggkqaletvqrllpvlcqahgltpeqvvaiashdggkqaletvqr
    llpvlcqahgltpqqvvaiasngggrpalesivaqlsrpdpalaaltndhlvalaclggr
    paldavkkl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.