PDB entry 4os1

View 4os1 on RCSB PDB site
Description: Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic peptide UK601 (bicyclic 1)
Class: hydrolase/hydrolase inhibitor
Keywords: bicyclic peptide, inhibitor, protease, disulfide bridges, cyclization, extracellular, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-02-12, released 2014-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-244)
      • engineered mutation (120)
      • engineered mutation (143)
    Domains in SCOPe 2.08: d4os1a_
  • Chain 'B':
    Compound: bicyclic peptide UK601 (bicyclic 1)
    Database cross-references and differences (RAF-indexed):
    • PDB 4OS1 (0-End)
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4os1A (A:)
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht

  • Chain 'B':
    No sequence available.