PDB entry 4os0

View 4os0 on RCSB PDB site
Description: Three-dimensional structure of the C65A-W54F double mutant of Human lipocalin-type Prostaglandin D Synthase apo-form
Class: isomerase
Keywords: lipocalin-type prostaglandin-d synthase, isomerase
Deposited on 2014-02-12, released 2014-08-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin-H2 D-isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGDS, PDS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41222
      • engineered mutation (53)
      • engineered mutation (64)
    Domains in SCOPe 2.08: d4os0a_
  • Chain 'B':
    Compound: Prostaglandin-H2 D-isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGDS, PDS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41222
      • engineered mutation (53)
      • engineered mutation (64)
    Domains in SCOPe 2.08: d4os0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4os0A (A:)
    mathhtlwmglallgvlgdlqaapeaqvsvqpnfqqdkflgrwfsaglasnssflrekka
    alsmaksvvapatdgglnltstflrknqcetrtmllqpagslgsysyrsphwgstysvsv
    vetdydqyallysqgskgpgedfrmatlysrtqtpraelkekftafckaqgftedtivfl
    pqtdkcmteq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4os0A (A:)
    qvsvqpnfqqdkflgrwfsaglasnssflrekkaalsmaksvvapatdgglnltstflrk
    nqcetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrma
    tlysrtqtpraelkekftafckaqgftedtivflpqtdkcmte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4os0B (B:)
    mathhtlwmglallgvlgdlqaapeaqvsvqpnfqqdkflgrwfsaglasnssflrekka
    alsmaksvvapatdgglnltstflrknqcetrtmllqpagslgsysyrsphwgstysvsv
    vetdydqyallysqgskgpgedfrmatlysrtqtpraelkekftafckaqgftedtivfl
    pqtdkcmteq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4os0B (B:)
    qvsvqpnfqqdkflgrwfsaglasnssflrekkaalsmaksvvapatdgglnltstflrk
    nqcetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrma
    tlysrtqtpraelkekftafckaqgftedtivflpqtdkcmte