PDB entry 4orz

View 4orz on RCSB PDB site
Description: HIV-1 Nef protein in complex with single domain antibody sdAb19 and an engineered Hck SH3 domain
Class: transferase/apoptosis/immune system
Keywords: SH3 domain, immunglobolin fold, Antibodies, Epitopes, HIV Antibodies, HIV Accessory Proteins, PxxP motif, Complementarity Determining Regions, TRANSFERASE-APOPTOSIS-IMMUNE SYSTEM complex
Deposited on 2014-02-12, released 2014-03-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631
      • engineered mutation (18-23)
    Domains in SCOPe 2.06: d4orza_
  • Chain 'B':
    Compound: Protein Nef
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: nef
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4orzb_
  • Chain 'C':
    Compound: single domain antibody sdAb19
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ORZ (Start-119)
    Domains in SCOPe 2.06: d4orzc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4orzA (A:)
    gahmggsediivvalydyyspfswdlsfqkgdqmvvleesgewwkarslatrkegyipsn
    yvarvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >4orzA (A:)
    iivvalydyyspfswdlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4orzB (B:)
    gamassntaatnadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegl
    iwsqrrqeildlwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepekvdaekevl
    vwrfdsklafhhmarelhpeyykda
    

    Sequence, based on observed residues (ATOM records): (download)
    >4orzB (B:)
    gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn
    ytpgpgirypltfgwcfklvpvepekvdaekevlvwrfdsklafhhmarelhpeyyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4orzC (C:)
    gamaevqlvesggglvqaggslrlfcaasgftfgtsnmawlrqapgkrrewvalitisgy
    tdyadsvkdrftisrdnakntvslqmnslkpedtaiyfcarrvgseydlwgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4orzC (C:)
    qlvesggglvqaggslrlfcaasgftfgtsnmawlrqapgkrrewvalitisgytdyads
    vkdrftisrdnakntvslqmnslkpedtaiyfcarrvgseydlwgqgtqvtvss