PDB entry 4orl

View 4orl on RCSB PDB site
Description: crystal structure of a duf4783 family protein (bacova_04304) from bacteroides ovatus atcc 8483 at 1.40 a resolution
Deposited on 2014-02-11, released 2014-03-05
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_04304
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7M2H0 (1-109)
      • leader sequence (0)
  • Heterogens: PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4orlA (A:)
gqeipagvitafkrgssqelskymgdkvnlvfqgrstnvdkqkataamqefftknkvsgf
nvnhqgkrdessfvigtlattngnfrvncflkkvqnqylihqiridkine