PDB entry 4or9

View 4or9 on RCSB PDB site
Description: Crystal structure of human calcineurin
Class: hydrolase/metal binding protein
Keywords: Calmodulin-binding, HYDROLASE-METAL BINDING PROTEIN complex
Deposited on 2014-02-11, released 2015-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: CALNA2, CALNB, CNA2, PPP3CB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4or9a_
  • Chain 'B':
    Compound: Calcineurin subunit B type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CNA2, CNB, PPP3R1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4or9b_
  • Heterogens: FE, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4or9A (A:)
    mgsshhhhhhssglvprgshmaapeparaapppppppppppgadrvvkavpfppthrlts
    eevfdldgiprvdvlknhlvkegrvdeeialriinegaailrrektmieveapitvcgdi
    hgqffdlmklfevggspantrylflgdyvdrgyfsiecvlylwvlkilypstlfllrgnh
    ecrhlteyftfkqeckikyservyeacmeafdslplaallnqqflcvhgglspeihtldd
    irrldrfkeppafgpmcdllwsdpsedfgneksqehfshntvrgcsyfynypavceflqn
    nnllsiiraheaqdagyrmyrksqttgfpslitifsapnyldvynnkaavlkyennvmni
    rqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlsicsddelmtegedqfdgsaaa
    rkeiirnkiraigkmarvfsvlreesesvltlkgltptgmlpsgvlaggrqtlqsatvea
    ieaekairgfspphricsfeeakgldrinermpprkdavqqdgfnslntahatenhgtgn
    htaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4or9A (A:)
    pppppppgadrvvkavpfppthrltseevfdldgiprvdvlknhlvkegrvdeeialrii
    negaailrrektmieveapitvcgdihgqffdlmklfevggspantrylflgdyvdrgyf
    siecvlylwvlkilypstlfllrgnhecrhlteyftfkqeckikyservyeacmeafdsl
    plaallnqqflcvhgglspeihtlddirrldrfkeppafgpmcdllwsdpsedfgneksq
    ehfshntvrgcsyfynypavceflqnnnllsiiraheaqdagyrmyrksqttgfpsliti
    fsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvteml
    vnvlsicsddelmarvfsvlrsfeeakgldrinermppr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4or9B (B:)
    mgneasyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvid
    ifdtdgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmv
    gnnlkdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4or9B (B:)
    asyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdt
    dgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnl
    kdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv