PDB entry 4or7

View 4or7 on RCSB PDB site
Description: Klebsiella pneumoniae dihydrofolate reductase complexed with NADPH and 6-ethyl-5-{3-[3-(pyrimidin-5-yl)phenyl]prop-1-yn-1-yl}pyrimidine-2,4-diamine
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: 5,6,7,8-tetrahydrofolate; 7,8-dihydrofolate, hydride shift, Oxidoreductase-Oxidoreductase inhibitor complex
Deposited on 2014-02-11, released 2014-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.213
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Klebsiella pneumoniae CG43 [TaxId:1244085]
    Gene: folA, D364_00170
    Database cross-references and differences (RAF-indexed):
    • Uniprot U5M636 (0-158)
      • expression tag (159-164)
    Domains in SCOPe 2.07: d4or7a1, d4or7a2
  • Heterogens: NAP, 25U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4or7A (A:)
    misliaalavdrvigmenampwnlpadlawfkrntlnkpvvmgrltwesigrplpgrkni
    visskpgsddrvqwvssveeaiaacgdveeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdydpdewesvfsefhdadaqnshsycfeilerrhhhhhh