PDB entry 4or5

View 4or5 on RCSB PDB site
Description: Crystal structure of HIV-1 Tat complexed with human P-TEFb and AFF4
Class: Transferase/Transcription
Keywords: Cdk9, Tat, AFF4, Zinc Finger, Transcription, RNA binding, Phosphorylation, Transferase-Transcription complex
Deposited on 2014-02-10, released 2014-04-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.225
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9, CDC2L4, TAK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4or5b1, d4or5b2
  • Chain 'C':
    Compound: protein tat
    Species: HIV-1 [TaxId:11706]
    Gene: TAT
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: AF4/FMR2 family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AFF4, AF5Q31, MCEF, HSPC092
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9, CDC2L4, TAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4or5f_
  • Chain 'G':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: protein tat
    Species: HIV-1 [TaxId:11706]
    Gene: TAT
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: AF4/FMR2 family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AFF4, AF5Q31, MCEF, HSPC092
    Database cross-references and differences (RAF-indexed):
  • Heterogens: YT3, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4or5B (B:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4or5B (B:)
    nnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivym
    hrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseay
    lqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhltt
    fslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqile
    ktpnrlkriwnwrace
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4or5F (F:)
    svecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalre
    ikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlsei
    krvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnryt
    nrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcg
    sitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqrids
    ddalnhdffwsdpmpsdlkgmlsthl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4or5F (F:)
    vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
    kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
    rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
    rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
    itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
    dalnhdffwsdpmpsdlkgmlsthl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.