PDB entry 4oq7

View 4oq7 on RCSB PDB site
Description: Predicting protein conformational response in prospective ligand discovery.
Class: oxidoreductase
Keywords: Model system, energy penalty, Boltzmann weights, flexible docking, OXIDOREDUCTASE
Deposited on 2014-02-07, released 2014-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:285006]
    Gene: CCP1 CCP CPO YKR066C, SCRG_04081
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3LRE1 (0-288)
      • engineered mutation (186-187)
    Domains in SCOPe 2.08: d4oq7a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4oq7A (A:)
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl