PDB entry 4opz

View 4opz on RCSB PDB site
Description: Crystal structure of stabilized TEM-1 beta-lactamase variant v.13 carrying G238S mutation in complex with boron-based inhibitor EC25
Class: hydrolase/hydrolase inhibitor
Keywords: Beta-lactamase, hydrolase-hydrolase inhibitor complex
Deposited on 2014-02-07, released 2015-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: TEM-94 ES-beta-lactamase
  Species: Escherichia coli [TaxId:562]
  Gene: bla-TEM-94
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8KMX3 (0-262)
    • engineered mutation (16)
    • engineered mutation (26)
    • engineered mutation (78)
    • engineered mutation (94)
    • engineered mutation (158)
    • engineered mutation (175)
  Domains in SCOPe 2.08: d4opza_
• Heterogens: 2UL, CA, ACT, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4opzA (A:)
  hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
  agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
  keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
  qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
  sqatmdernrqiaeigaslikhw