PDB entry 4oop

View 4oop on RCSB PDB site
Description: Arabidopsis thaliana dUTPase with with magnesium and alpha,beta-imido-dUTP
Class: hydrolase
Keywords: dUTPase, hydrolysis, dUTP, HYDROLASE
Deposited on 2014-02-03, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DUT, DUT1, At3g46940, T6H20.30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oopa_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DUT, DUT1, At3g46940, T6H20.30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oopb_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DUT, DUT1, At3g46940, T6H20.30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oopc_
  • Heterogens: DUP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oopA (A:)
    macvnepspklqkldrngihgdsspspffkvkklsekaviptrgsplsagydlssavdsk
    vpargkaliptdlsiavpegtyariaprsglawkhsidvgagvidadyrgpvgvilfnhs
    dadfevkfgdriaqliiekivtpdvvevddldetvrgdggfgstgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oopA (A:)
    pspffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyar
    iaprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpd
    vvevddldetvrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oopB (B:)
    macvnepspklqkldrngihgdsspspffkvkklsekaviptrgsplsagydlssavdsk
    vpargkaliptdlsiavpegtyariaprsglawkhsidvgagvidadyrgpvgvilfnhs
    dadfevkfgdriaqliiekivtpdvvevddldetvrgdggfgstgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oopB (B:)
    pspffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyar
    iaprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpd
    vvevddldetvrgdggfgstgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4oopC (C:)
    macvnepspklqkldrngihgdsspspffkvkklsekaviptrgsplsagydlssavdsk
    vpargkaliptdlsiavpegtyariaprsglawkhsidvgagvidadyrgpvgvilfnhs
    dadfevkfgdriaqliiekivtpdvvevddldetvrgdggfgstgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oopC (C:)
    spffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyari
    aprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpdv
    vevddld