PDB entry 4ood

View 4ood on RCSB PDB site
Description: Structure of K42Y mutant of sperm whale myoglobin
Class: oxygen storage
Keywords: globin, oxygen storage, oxygen binding
Deposited on 2014-01-31, released 2014-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.143
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
    • engineered mutation (42)
  Domains in SCOPe 2.06: d4ooda_
• Heterogens: HEM, SO4, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4oodA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetleyfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgdfgadaqgamnkalelfrkdiaakykelgyqg