PDB entry 4ood

View 4ood on RCSB PDB site
Description: Structure of K42Y mutant of sperm whale myoglobin
Class: oxygen storage
Keywords: globin, oxygen storage, oxygen binding
Deposited on 2014-01-31, released 2014-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.143
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (42)
    Domains in SCOPe 2.05: d4ooda_
  • Heterogens: HEM, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4oodA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetleyfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg