PDB entry 4oo0

View 4oo0 on RCSB PDB site
Description: Crystal Structure of Maf-like protein BceJ2315_23540 from Burkholderia cenocepacia
Class: hydrolase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Maf-like protein, HYDROLASE
Deposited on 2014-01-29, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maf-like protein BCAL2394
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAL2394
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oo0a_
  • Chain 'B':
    Compound: Maf-like protein BCAL2394
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAL2394
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oo0b_
  • Heterogens: PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oo0A (A:)
    mahhhhhhmgtleaqtqgpgsmpsstspalfptplfqtlylasqsprrqellqqigvrfe
    lllprpdedaealeaelpgeaadayvrrvtvakaeaararlvasgkpaapvlvadttvti
    dgailgkptdaddalamltrlagrehavltavavidasgellppalsrssvrfaaasrda
    yvryvetgepfgkagayaiqgraaefieridgshsgimglplfetaallrtarvaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oo0A (A:)
    alfptplfqtlylasqsprrqellqqigvrfelllprpdedaealeaelpgeaadayvrr
    vtvakaeaararlvasgkpaapvlvadttvtidgailgkptdaddalamltrlagrehav
    ltavavidasgellppalsrssvrfaaasrdayvryvetgepfgkagayaiqgraaefie
    ridgshsgimglplfetaallrtarvaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oo0B (B:)
    mahhhhhhmgtleaqtqgpgsmpsstspalfptplfqtlylasqsprrqellqqigvrfe
    lllprpdedaealeaelpgeaadayvrrvtvakaeaararlvasgkpaapvlvadttvti
    dgailgkptdaddalamltrlagrehavltavavidasgellppalsrssvrfaaasrda
    yvryvetgepfgkagayaiqgraaefieridgshsgimglplfetaallrtarvaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oo0B (B:)
    tplfqtlylasqsprrqellqqigvrfelllprpdedaealeaelpgeaadayvrrvtva
    kaeaararlvasgkpaapvlvadttvtidgailgkptdaddalamltrlagrehavltav
    avidasgellppalsrssvrfaaasrdayvryvetgepfgkagayaiqgraaefieridg
    shsgimglplfetaallrtarvaf