PDB entry 4onm

View 4onm on RCSB PDB site
Description: Crystal structure of human Mms2/Ubc13 - NSC697923
Class: ligase
Keywords: E2 ubiquitin conjugating enzyme, E1, E3, ubiquitin, covalent adduct, LIGASE
Deposited on 2014-01-28, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4onma_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4onmb_
  • Heterogens: GOL, N2F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4onmA (A:)
    gplgspefmavstgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiig
    pprtnyenriyslkvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqns
    ysikvvlqelrrlmmskenmklpqppegqtynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4onmA (A:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqtynn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4onmB (B:)
    gplgspefmaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtf
    klelflpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqall
    sapnpddplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >4onmB (B:)
    aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
    ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
    andvaeqwktneaqaietarawtrlyamn