PDB entry 4onl

View 4onl on RCSB PDB site
Description: Crystal structure of human Mms2/Ubc13_D81N, R85S, A122V, N123P
Class: ligase
Keywords: ubc13, mms2, E2, ubiquitin conjugating enzyme, LIGASE
Deposited on 2014-01-28, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MMS2, UBE2V2, UEV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4onla_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, UBE2N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61088
      • conflict (88)
      • engineered mutation (92)
      • engineered mutation (129-130)
    Domains in SCOPe 2.06: d4onlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4onlA (A:)
    gplgspefmavstgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiig
    pprtnyenriyslkvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqns
    ysikvvlqelrrlmmskenmklpqppegqtynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4onlA (A:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqtynn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4onlB (B:)
    gplgspefmaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtf
    klelflpeeypmaapkvrfmtkiyhpnvnklgsicldilkdkwspalqirtvllsiqall
    sapnpddplvpdvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >4onlB (B:)
    aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
    ypmaapkvrfmtkiyhpnvnklgsicldilkdkwspalqirtvllsiqallsapnpddpl
    vpdvaeqwktneaqaietarawtrlyamn