PDB entry 4one

View 4one on RCSB PDB site
Description: Crystal Structure of a 3-oxoacyl-[acyl-carrier protein] reductase from Brucella melitensis
Class: oxidoreductase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, short chain dehydrogenase, KR domain, reductase, OXIDOREDUCTASE
Deposited on 2014-01-28, released 2014-02-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.133
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Brucella melitensis [TaxId:224914]
    Gene: BMEI0026
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4onea_
  • Chain 'B':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Brucella melitensis [TaxId:224914]
    Gene: BMEI0026
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4oneb_
  • Chain 'C':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Brucella melitensis [TaxId:224914]
    Gene: BMEI0026
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4onec_
  • Chain 'D':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Brucella melitensis [TaxId:224914]
    Gene: BMEI0026
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4oned_
  • Heterogens: CL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oneA (A:)
    mahhhhhhmsrqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglgg
    kvaffksdlaavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdv
    nlrgtvfftqavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqgl
    alrlaearigvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglag
    gdfifatgsaihadgglsiakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oneA (A:)
    srqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksdl
    aavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvfft
    qavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaeari
    gvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglaggdfifatgs
    aihadgglsiakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oneB (B:)
    mahhhhhhmsrqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglgg
    kvaffksdlaavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdv
    nlrgtvfftqavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqgl
    alrlaearigvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglag
    gdfifatgsaihadgglsiakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oneB (B:)
    srqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksdl
    aavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvfft
    qavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaeari
    gvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglaggdfifatgs
    aihadgglsiakl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4oneC (C:)
    mahhhhhhmsrqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglgg
    kvaffksdlaavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdv
    nlrgtvfftqavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqgl
    alrlaearigvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglag
    gdfifatgsaihadgglsiakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oneC (C:)
    srqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksdl
    aavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvfft
    qavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaeari
    gvfevrpgiiraarydaliegglvpmkrwgeasdvgaivaglaggdfifatgsaihadgg
    lsiakl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4oneD (D:)
    mahhhhhhmsrqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglgg
    kvaffksdlaavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdv
    nlrgtvfftqavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqgl
    alrlaearigvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglag
    gdfifatgsaihadgglsiakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oneD (D:)
    srqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksdl
    aavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvfft
    qavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaeari
    gvfevrpgiirtarydaliegglvpmkrwgeasdvgaivaglaggdfifatgsaihadgg
    lsiakl