PDB entry 4omu

View 4omu on RCSB PDB site
Description: Crystal structure of shikimate dehydrogenase (AroE) from Pseudomonas putida
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2014-01-27, released 2014-06-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.181
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: aroE-1, aroE, aroE1, PP_0074
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4omua1, d4omua2
  • Chain 'B':
    Compound: Shikimate dehydrogenase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: aroE-1, aroE, aroE1, PP_0074
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88RQ5 (0-273)
      • expression tag (275)
      • expression tag (276-280)
      • expression tag (276-282)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4omuA (A:)
    mdqyvvfgnpighsksplihrlfaeqtgqdleyatllapldefsdcargffkqgsggnvt
    vpfkeeafrlcdsltprarragavntlskladgtlqgdntdgaglvrdltvnagvelagk
    rililgaggavrgvlepilahkpqslvianrtvekaeqlarefdelgpvvasgfawlqep
    vdviinatsaslagelppiadslveagrtvcydmmygkeptpfcqwatklgaakvldglg
    mlaeqaaeaffiwrgvrpdtapvlaelrrqlarggsrenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omuA (A:)
    mdqyvvfgnpighsksplihrlfaeqtgqdleyatllapldefsdcargffkqgsggnvt
    vpfkeeafrlcdsltprarragavntlskladgtlqgdntdgaglvrdltvnagvelagk
    rililgaggavrgvlepilahkpqslvianrtvekaeqlarefdelgpvvasgfawlqep
    vdviinatsaslagelppiadslveagrtvcydmmygkeptpfcqwatklgaakvldglg
    mlaeqaaeaffiwrgvrpdtapvlaelrrqlarg
    

  • Chain 'B':
    No sequence available.