PDB entry 4omj

View 4omj on RCSB PDB site
Description: Crystal structure of SPF bound to 2,3-oxidosqualene
Class: transport protein
Keywords: cholesterol synthesis, squalene, 2,3-oxidosqualene, SEC14-like, CRAL-TRIO domain, hydrophobic ligand transporter, TRANSPORT PROTEIN
Deposited on 2014-01-27, released 2015-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sec14-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: C22orf6, KIAA1186, KIAA1658, SEC14L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4omja1, d4omja2
  • Chain 'B':
    Compound: sec14-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: C22orf6, KIAA1186, KIAA1658, SEC14L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4omjb1, d4omjb2
  • Heterogens: SO4, CL, 2TX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4omjA (A:)
    gshmsgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlr
    khvefrkqkdidniiswqppeviqqylsggmcgydldgcpvwydiigpldakgllfsask
    qdllrtkmrecelllqecahqttklgrkvetitiiydceglglkhlwkpaveaygeflcm
    feenypetlkrlfvvkapklfpvaynlikpflsedtrkkimvlganwkevllkhispdqv
    pveyggtmtdpdgnpkckskinyggdiprkyyvrdqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omjA (A:)
    msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
    efrkqkdidniiswqppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdl
    lrtkmrecelllqecahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfee
    nypetlkrlfvvkapklfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpve
    yggtmtdpdgnpkckskinyggdiprkyyvrdqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4omjB (B:)
    gshmsgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlr
    khvefrkqkdidniiswqppeviqqylsggmcgydldgcpvwydiigpldakgllfsask
    qdllrtkmrecelllqecahqttklgrkvetitiiydceglglkhlwkpaveaygeflcm
    feenypetlkrlfvvkapklfpvaynlikpflsedtrkkimvlganwkevllkhispdqv
    pveyggtmtdpdgnpkckskinyggdiprkyyvrdqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omjB (B:)
    msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
    efrkqkdidniiswqppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdl
    lrtkmrecelllqecahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfee
    nypetlkrlfvvkapklfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpve
    yggtmtdpdgnpkckskinyggdiprkyyvrdqv