PDB entry 4om7

View 4om7 on RCSB PDB site
Description: Crystal structure of TIR domain of TLR6
Class: signaling protein
Keywords: TIR fold, Protein interaction, SIGNALING PROTEIN
Deposited on 2014-01-26, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toll-like receptor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: Tlr6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4om7a_
  • Chain 'B':
    Compound: Toll-like receptor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: Tlr6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4om7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4om7A (A:)
    lqfhafisysehdsawvkselvpylekediqiclhernfvpgksiveniincieksyksi
    fvlspnfvqsewchyelyfahhnlfhegsnnlilillepipqnsipnkyhklkalmtqrt
    ylqwpkekskrglfwaniraafnmkltlvtenndvksmkltlvtenndvkslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4om7A (A:)
    lqfhafisysehdsawvkselvpylekediqiclhernfvpgksiveniincieksyksi
    fvlspnfvqsewchyelyfahhnlfhegsnnlilillepipqnsipnkyhklkalmtqrt
    ylqwpkekskrglfwaniraafn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4om7B (B:)
    lqfhafisysehdsawvkselvpylekediqiclhernfvpgksiveniincieksyksi
    fvlspnfvqsewchyelyfahhnlfhegsnnlilillepipqnsipnkyhklkalmtqrt
    ylqwpkekskrglfwaniraafnmkltlvtenndvksmkltlvtenndvkslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4om7B (B:)
    lqfhafisysehdsawvkselvpylekediqiclhernfvpgksiveniincieksyksi
    fvlspnfvqsewchyelyfahhnlfhegsnnlilillepipqnsipnkyhklkalmtqrt
    ylqwpkekskrglfwaniraafn