PDB entry 4om4

View 4om4 on RCSB PDB site
Description: Crystal structure of CTX A2 from Taiwan Cobra (Naja naja atra)
Class: toxin
Keywords: Five beta sheets, three functional loops, endocytosis, heparin, heparan sulfate, TOXIN
Deposited on 2014-01-26, released 2014-06-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytotoxin 2
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4om4a_
  • Chain 'B':
    Compound: cytotoxin 2
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4om4b_
  • Chain 'C':
    Compound: cytotoxin 2
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4om4c_
  • Chain 'D':
    Compound: cytotoxin 2
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4om4d_
  • Chain 'E':
    Compound: cytotoxin 2
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4om4e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4om4A (A:)
lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4om4B (B:)
lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4om4C (C:)
lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4om4D (D:)
lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4om4E (E:)
lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn